SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024906 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024906
Domain Number 1 Region: 31-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.07e-42
Family Laminin G-like module 0.00068
Further Details:      
 
Domain Number 2 Region: 285-488
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.76e-40
Family Laminin G-like module 0.00063
Further Details:      
 
Domain Number 3 Region: 227-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000882
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000385
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024906   Gene: ENSSSCG00000025146   Transcript: ENSSSCT00000023916
Sequence length 513
Comment pep:known chromosome:Sscrofa10.2:6:73850685:73857935:1 gene:ENSSSCG00000025146 transcript:ENSSSCT00000023916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQCSPHFPMCPPEACGPDATCVNRPDGRGYTCRCHLGRSGRRCEEGVTVTTPSMSGTGSY
LALPALTNTHHELRLDVEFKPLAPDGILVFSGGQSGPVEDFVSLAMVGGHLEFRYELGSG
LAILRSSEPLALGRWHHVSAERFNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGGVE
PSVQLPPATNVSAHFHGCIGEVSVNGKRLDLTYSFLGSRGIGQCYDSSPCERQPCQNGAT
CMPAGEYEFQCLCRDGFKGDLCEHEENPCQLHEPCLHGGTCQGTRCLCPPGFSGPRCQQG
SVHGIAESDWHLEGSGGNDAPGQYGAYFYDDGFLALPGRVFSRSLPEVPETIELEVRTST
ASGLLLWQGVEVGESGRGKDFISLGLQDGHLVFSYQLGSGEARLVSEDPINDGEWHRVTA
LREGRRGSIQVDGEELVSGQSPGPNVAVNTKGSVYIGGAPDVAALTGGRFSSGITGCIKN
LVLHSARPGALPPQPLDLQHRAQAGANMRPCPS
Download sequence
Identical sequences ENSSSCP00000024906 ENSSSCP00000024906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]