SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024916 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024916
Domain Number 1 Region: 70-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-26
Family Pentraxin (pentaxin) 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000024916
Domain Number - Region: 643-931
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00119
Family Rhodopsin-like 0.036
Further Details:      
 
Domain Number - Region: 6-34
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00735
Family C-type lectin domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024916   Gene: ENSSSCG00000005591   Transcript: ENSSSCT00000031320
Sequence length 1011
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:299032965:299050740:1 gene:ENSSSCG00000005591 transcript:ENSSSCT00000031320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VETANKVCKFSGQRLSWWQAQESCEQRFGHLVLPPPDGVLAPRLPNPIWVGQRESPLRRP
PQRRAHTTAALRFGERTADRAARLRKPLPALGALTACAHVQWDAASPDTAALFSLAVPAL
ANALQLRAFAEPGGAVHLALVVRGHHAPFRAAFRADGHWHHVCATWEQLGGRWALFADGR
RRAGARGLGAGHPLPPGGVLVLGQDQDSLGGGFSARDAFSGNLTDFHLWARTLSPVQLNR
ARSCAPPLGGLLFRWDLGALDVTPSLLPPVWVRLFCPVPSEECPTWDPGPRTESPLLCLQ
QLPFLCCYGTENYLRLQEAQSWSGQDVISQVNALANATVLFPDPLSEEYGDLSPAEASSF
LGILERVLAKEAAPLGPAALLAVVQFLKRVAALGAWESEPGTGPWEQLGQAVVSVASLVL
EEPLASAWLKVGEVVGGPMALVASVQRLAPLLSSVLTSERPRMHFQHRQAGLELQRLHLR
EAGPEGSTFTMPGGHPEGPGHICIPAGEVRRLLHPGLSGVTVIHSWFSSSVFKHMPGAPG
QGPPAPDSSEETSRMQRFLSTQVGSAIISSDVWDEAGEVNTAVTFHLQHQVQVLKDKRQK
TKKKLVEPVCAFWNFSISPDSGGSWATSGCSVTALYRDSTACFCNHSTNFAILLQVYDVQ
RSPEDESLLRTLSFVGCGVSFCALATTFLLFLAAGVPKSERATVHKNLTFSLASAEGFLM
ASEWAKDNEVACVAVTAVMHLLFLVAFSWMLVEGLLLWSRVVAVSMRPGPRMRLYYATGW
GVPVVIVAITLATSPQDYVATGHCWLNVHTDTIWAFVGPVLFVLTANTCILVRVVIVTVS
SARRRARMLSPQPCVQQQLRIQMWATVKPVLVLLPVLGLTWLVGVLVHLSPAWAYAAVGL
NSFQGPYIFLVYAAYNGEVRSALQRMTEKKAAEAFPACSSPVGPGFHPGPSGPWEMARDN
PVVLAPPRRHLALRERVWGGGQSPRNPTTFSSIAEPERPAVELTAFKPSGT
Download sequence
Identical sequences ENSSSCP00000024916 ENSSSCP00000024916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]