SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024917 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024917
Domain Number 1 Region: 20-353
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.06e-92
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024917   Gene: ENSSSCG00000028733   Transcript: ENSSSCT00000030149
Sequence length 354
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:41642080:41677119:-1 gene:ENSSSCG00000028733 transcript:ENSSSCT00000030149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKK
KENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTI
ADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKD
EDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILA
LHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVAVVVHCGSGPNRG
HYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRE
Download sequence
Identical sequences D2HBZ5 G5AU60
HGL_H00000226440-1 ENSSSCP00000024917 ENSMMUP00000030712 9544.ENSMMUP00000030712 ENSSSCP00000024917 ENSMMUP00000030712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]