SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024925 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024925
Domain Number 1 Region: 7-178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-52
Family SPRY domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024925   Gene: ENSSSCG00000029475   Transcript: ENSSSCT00000028418
Sequence length 187
Comment pep:novel chromosome:Sscrofa10.2:12:34136167:34138282:-1 gene:ENSSSCG00000029475 transcript:ENSSSCT00000028418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESLKNAVKVILDYNTAHNKVALSQNFTVASAADTSQDYQPHPQRFTYCSQVLGLHCYKKG
IHYWEVELQKNNFCGVGVCYGSMPRHGPESRLGRNSASWCVEWFNTKISAWHNNVEKTLP
STKSTRVGVLLNCDHGFVIFFAVADKVHLLYKFKVAFAEALYPAFWVFSAGATLSICSTR
TYILIPR
Download sequence
Identical sequences ENSSSCP00000024925 ENSSSCP00000024925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]