SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024991 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024991
Domain Number 1 Region: 3-49
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000111
Family Laminin G-like module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024991   Gene: ENSSSCG00000023094   Transcript: ENSSSCT00000024740
Sequence length 49
Comment pep:novel chromosome:Sscrofa10.2:9:121785080:121785226:-1 gene:ENSSSCG00000023094 transcript:ENSSSCT00000024740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLNDGQWHEVRFLAKENFAILTIDGDEASAVRTNSPLQVKTGEKYFFG
Download sequence
Identical sequences F7C063 F7I3T2 G1QF08 Q75MF8
ENSCJAP00000046548 ENSCJAP00000046548 ENSSSCP00000024991 ENSSSCP00000024991 ENSMLUP00000022291 ENSECAP00000005300 ENSMLUP00000022291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]