SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025066 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025066
Domain Number 1 Region: 1905-2284
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.3e-85
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000508
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000025066
Domain Number - Region: 2346-2450,2578-2710,2782-2829
Classification Level Classification E-value
Superfamily ARM repeat 0.000107
Family Armadillo repeat 0.057
Further Details:      
 
Domain Number - Region: 1481-1755,1820-1870,2258-2283,2337-2515
Classification Level Classification E-value
Superfamily ARM repeat 0.00237
Family MIF4G domain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025066   Gene: ENSSSCG00000008382   Transcript: ENSSSCT00000028791
Sequence length 2989
Comment pep:novel chromosome:Sscrofa10.2:3:84252665:84513413:1 gene:ENSSSCG00000008382 transcript:ENSSSCT00000028791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQNVCHLCLVLEKVSDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFNQ
VVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEQLNIERECNEGSTERQKS
VEKKSNSTKICNLTEEESSKGSDPFSLWSTDEKEKLLLCVAKIFQIQFPLYTAYKHNTHP
TIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFLI
AHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTVK
EPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETSI
AKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKHC
SRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPGVHTEQTLYLASMLIKALWNNALAAKAQ
LSKQSSFASLLNTNLPIGNKKEEEELRRAAPSPWSPAASPQSSDNSDTHQSGGSDIEMDE
QLINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNSSHASQS
AGSPGSEVQSEDIADIEALKEEDEDDDHGHNPPKSSCGTDLRNRKLESQAGICLGDSQGP
SERSGTSNGTGKDLVFNTESLPSVDNRIRMLDACSHSEDPEHDISGEMNAAHIAQASQES
CITRTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHHDGVVTLHKFHHHQHSINHMV
DDMLSADDVSCSSSQVSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLAS
IYHEHLSQGPAVHKHQFNSNAVTDINLDNVCKKGNTLLWDIVQDDDAVNLSEGLINEAEK
LLCSLVCWFTDRQIRMRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDTHWITM
WAEKELNMMKLFFDNLVYYIQGVREGRQKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFR
LSLEQVDILWHCLVEDSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETI
SMTGLNLFQHLCNLARLATSAYDGGSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYY
INGKTGLEKEQEFISKCMESLMIASSSLEQESHSSLTVIERGLLMLKTHLEAFRRRFAYH
LRQWQIEGTGISSHLKALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWY
ENLQKEQINQQAQLQEFGQSSRKGEFPGGLMGPVRMISSGHELTTDYDEKALHELGFKDM
QMVFVSLGAPRRERKGEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKP
PSGKVAVEDSESLRCEELHLHAENLSRRVWELLMLLPTCPNMLMAFQNISDEQNNDAPNW
KELLKIKSAHKLLYALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVENSKNSWS
CKFVAAGGLQQLLEIFNSGILEPKEQESWTVWQLDCLACLLKLICQFAVDPSDLDLAYHD
VFAWSGIAESHRKRTWPGKSRKAAGDHAKGLHIPRLTEVFLVLVQGTSLIQRLMSVAYTY
DNLAPRVLKAQSDHRSRHEVSHYSMWLLVSWAHCCSLVKSSLADSDHLQDWLKKLTLLIP
ETAVRHESCNGLYKLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDDYEEEP
MLKPGCKEYFWLLCKLIDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDGNIEDD
GLTGLLRLATSVIKHKPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAY
DLLVEMVKGSVENYRLIHNWVMAQHMQSHAPYKWDYWPHEDVRAECRFVGLTNLGATCYL
ASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYT
MDKQPLNTGEQKDMTEFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTA
EEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILS
FNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKSDRKEGFKEVGDHSKDTES
YEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSAQLASECFG
GEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRMEPEEENGKEYKFDVSSELLEWIWHDN
MQFLQDKNIFEHTYFGFMWQLCSCIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTM
LQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLR
PVHAHLYLQPGMEDGSDDMDASVEDIGGRSCVTRFVRTLLLIMEHGVKPHSKHLTEYFAF
LYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLA
EEKYRPAALEKMIALVALLVEQSRSERHLTLSQTDMAALTGGKGFPFLFQHIRDGINIRQ
TCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFAS
YILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAA
YLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAA
VHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFW
YNVCADCPENIRLIVQNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQS
PAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELFNLMQLFIAQRPDMREEELEDIKQFK
KTTISCYLRCLDGRSCWTTLIRLFVILSQSTQDKYSLFTVFSNRGLLLL
Download sequence
Identical sequences ENSSSCP00000008947 ENSSSCP00000025066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]