SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025106 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025106
Domain Number 1 Region: 124-296
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.58e-49
Family Prokaryotic proteases 0.000000108
Further Details:      
 
Domain Number 2 Region: 311-407
Classification Level Classification E-value
Superfamily PDZ domain-like 1.24e-23
Family HtrA-like serine proteases 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025106   Gene: ENSSSCG00000027150   Transcript: ENSSSCT00000023070
Sequence length 410
Comment pep:known scaffold:Sscrofa10.2:JH118982.1:100687:104444:1 gene:ENSSSCG00000027150 transcript:ENSSSCT00000023070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRAGRGAGWSLRGWRALAGVRWGKGPLLTPDLRALLTSGTPDPRAGVTYGTPGFRAR
LSVGVPEPRTCLTSGTSDPRVGDPRTREDSGTPGNRPRQWLAVAXSEPPHIRALPQPPNP
RHPFSGREVPISNGSGFVVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAVVTAVDPVDD
RSLVPILLQEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPAKDLGLP
QTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLRRGEKK
NSWFGNSGSQRRYIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLR
PGDVILAIGEQLVQNAEDIYEAVRTQSQLAVRIRRGPETLTLYVTPEVTE
Download sequence
Identical sequences ENSSSCP00000025106 ENSSSCP00000025106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]