SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025137 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025137
Domain Number 1 Region: 689-765,850-910
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000157
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025137   Gene: ENSSSCG00000011859   Transcript: ENSSSCT00000025511
Sequence length 918
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:144767549:144791646:-1 gene:ENSSSCG00000011859 transcript:ENSSSCT00000025511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSTENAFGLTSSKVSVESGQNDSPTSGGLRLASSSGAGDGSPGSQTETVSRSAPLVRG
GQSTALWFVSNSETLADAPGSSTAHPEVENASVLTRFSASAPQSGRSDTTLGGGSSEPDT
ESSSSSSSSSTSLDSWAPHGEHLTTEDSPELGVGSESEEGASEGASRTRAHRPHTLATLT
GIGERTLRSLTNGSTTPGDAGRSEAEDTESATLQGNVTAAGDSHLVSSSLAASRTLGVTG
TSSDPVHSTDPEHRTSGDYTDHTYVSAPFTKGERTLLSIADNSSAADLRESSTSSVKISN
ASHPDSSSPSLAQTERGNASSHKGEPALPSTEVQVLHTARPPSHTPTVILPSTLDAHADS
VGDPSSSSSGPPLPPPSVSQSYHLFLSTVPSTGASTHRLQSTPDVPTPLSSLPPPSPASL
TTSTPAEPAISQTTLPPLSSTLVPPRPRDAPVTSVWTLTMASSVAVLPNSQTADPKIQSN
PDLGNVITESKLPSLETRTPEATEAVTVRSTLRIPSPPAFTEASTEQTPPATSTSLAQTS
SASAATTLKISHPPTPSPSPPPRTAAPGGGPTAAQTVAGKQPPPTSPEMLVVQVSTGGAV
IPEKSQAHGDAAAGSARLTSAPTSAEELTTERGRAGENSPAPHFLRTSPAPQTTHISTAE
VVTAASTTPGAQNSTQSPTTPSSPASVNSCTPRPCLHDGKCVVDPTTRGHRCVCSPSWQG
QDCSVDVNECLSNPCPPLATCNNTQGSFTCRCPVGYQLEKGICNLVRTFMTEFKLKKTFL
NTTMEQHADLREVENEITKTLNVCFSTLPGYTRSTAHASREPSAVVMSLQSTFSLASNVT
LFDLADGMQKCVNACRSSAEVCQLLGSQKRIFRAGSLCKRKTPECDKETSICTDLDGVAL
CQCKSGYFQFNKMDHSCR
Download sequence
Identical sequences ENSSSCP00000025137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]