SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025243 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025243
Domain Number 1 Region: 193-396,633-825
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.73e-86
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00029
Further Details:      
 
Domain Number 2 Region: 22-134
Classification Level Classification E-value
Superfamily RING/U-box 9.54e-21
Family Zf-UBP 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025243   Gene: ENSSSCG00000027594   Transcript: ENSSSCT00000029188
Sequence length 827
Comment pep:known chromosome:Sscrofa10.2:13:202679047:202709145:1 gene:ENSSSCG00000027594 transcript:ENSSSCT00000029188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKRTKGKTVPIDDSSESLEPTCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
SEEETENPSVWLCLKCGHQGCGRDSQEQHALKHYMTPRSEPHCLVLSLDNWSVWCYLCDD
EVQYCNSNRLGQVVDYVRKQAGITAPKSGKKAAKDNGNIELENKKLEKESKNEQEREKKE
NKAKENPSMNSASQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEP
PDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGIVTPRELFSQVCKKAVRFKGYQQQ
DSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSVPSFVDRI
FGGELTSTIMCDECRTVSLVHESFLDLSLPVLDDQSGKKSINDKNLKKTMEDEDKDCEEE
KDNDSYIKERNDIPSGTSKHLQKKAKKQAKKQAKYQRRQQKIQGKVLHLNDVCAVDHPED
NECEVEASTSEVDVKSSHTSQEEVMHKECCEKDLNGHEKTVESVTDNQKSTEEGDMKIVN
LDNDLEVLASSPTECTGNLNGAYLKAGSNGEVDISSGFKNLNLNAALEPDEINIEILNDD
LTPGAKVYEVVNEDPETAFCTLANREAFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCT
RRQYSGPKANIKEGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFP
EILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANSHLSDLVL
HGDIPQDFEMESTKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL
Download sequence
Identical sequences ENSSSCP00000025243 ENSSSCP00000025243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]