SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025254 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025254
Domain Number 1 Region: 406-437,475-579,693-808
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-50
Family Phosphate binding protein-like 0.0000804
Further Details:      
 
Domain Number 2 Region: 289-390
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000073
Family L-arabinose binding protein-like 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000025254
Domain Number - Region: 571-669
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.002
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025254   Gene: ENSSSCG00000029635   Transcript: ENSSSCT00000026993
Sequence length 1040
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:77585771:77595944:1 gene:ENSSSCG00000029635 transcript:ENSSSCT00000026993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVRALWLGLALALGPGPAAGHPQPCGVLTRLGGSMRLGALLPRAPAARARVRAALARA
ALEPGLPHNLSLELVAAAPLARDPASLARGLCQALAAPGVAAVLAFPEARPELLQLHFLA
AATETPVLSVLRREARAPLGAPNPFHLQLDWASPLETLLDVLVSVLQVHTWEDVGLVLCR
VRDPSGLVALWTSRAGWAPKLVLDLSRQDPGNAGLQARLAPLGAPEGGTAPVPIAVLLGC
DAVRAQQVLQAAPPGPRWLLGTPLPAEALPTEGLPPGLLAMGEVARPPLEAAIHDAVELV
ARALGSAARVQPERALLPTMVNCNDLQPGSESSGLFLARFLANTSFQGHTGPVWVTGSSQ
VHISRRFRVWSLRHDPLGAPAWATVGTWRDGRLESETGGVAARPPPQPGAPGARPKLRVV
TLVEHPFVFAREPDEDGQCPAGQLCLAPGTNDSATLDALFAGLANGSVPRALRRCCYGYC
IDLLERLAEDTPFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFSSPFFSTSLGIMVRSRDTASPIGAFMWPLHWSMWLGVFAALHLTALFLTLYEWRSP
YGLTPRGRNRATVFSYSSALNLCYAILFGRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKKSFPEMYAHMRRH
SAPTTPHGVSMLTSDPPKLNAFIMDKSLLDYEVSIDADCRLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMGIYHFSGLFVLLCL
GLGSALLSSLGEHVFYHLALPRIRRGNKLQYWLHTSQRIHRALNTEPPDGQEEAEPEPRC
PEEPQQDTVAPTMGPRSWTRVRRAVVRERRVRFLLEPAMATATPDAEVDEAVLPSCPVWL
CSNGRLATELPSRAPRPGELEELEQHIADTHERLRQALVRRGELLAQLGDSAHDQPCPLL
QAFDKPDGPRFHSRRGGQSE
Download sequence
Identical sequences ENSSSCP00000025254 ENSSSCP00000025254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]