SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025331 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025331
Domain Number 1 Region: 165-356
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-34
Family Clostridium neurotoxins, the second last domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000025331
Domain Number - Region: 50-180
Classification Level Classification E-value
Superfamily ARM repeat 0.0561
Family Mo25 protein 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025331   Gene: ENSSSCG00000021829   Transcript: ENSSSCT00000027784
Sequence length 384
Comment pep:novel chromosome:Sscrofa10.2:11:11141413:11236840:1 gene:ENSSSCG00000021829 transcript:ENSSSCT00000027784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELRGPSGSGSVVLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRDIVETVLNLLVG
GEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIE
QVLLKMSAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLN
QMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLY
CFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSE
IRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQ
IFAIHQLGPGYKVVKPSYYKFYGK
Download sequence
Identical sequences ENSSSCP00000025331 ENSSSCP00000025331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]