SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025417 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025417
Domain Number 1 Region: 1133-1306
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-30
Family Laminin G-like module 0.00062
Further Details:      
 
Domain Number 2 Region: 1599-1624,1674-1832
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-21
Family Laminin G-like module 0.00000301
Further Details:      
 
Domain Number 3 Region: 1444-1541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-17
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 4 Region: 67-137
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000846
Family Ovomucoid domain III-like 0.0041
Further Details:      
 
Domain Number 5 Region: 422-471
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000101
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 6 Region: 756-825
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000333
Family Ovomucoid domain III-like 0.0073
Further Details:      
 
Domain Number 7 Region: 144-213
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000416
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Domain Number 8 Region: 297-344
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000333
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 9 Region: 574-621
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000998
Family Ovomucoid domain III-like 0.0056
Further Details:      
 
Domain Number 10 Region: 233-278
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.0089
Further Details:      
 
Domain Number 11 Region: 486-522
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000152
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 12 Region: 349-406
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000277
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000025417
Domain Number - Region: 1000-1027
Classification Level Classification E-value
Superfamily SEA domain 0.0262
Family SEA domain 0.009
Further Details:      
 
Domain Number - Region: 664-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number - Region: 710-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0523
Family Laminin-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025417   Gene: ENSSSCG00000027173   Transcript: ENSSSCT00000023306
Sequence length 1835
Comment pep:novel scaffold:Sscrofa10.2:GL895967.2:73280:94000:1 gene:ENSSSCG00000027173 transcript:ENSSSCT00000023306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLPLERDPRQQHGVSLLVRYFMIPCNVCLILLATSTLGFAVLLFLNNYKPGTHFTPVP
PTPPDACRGMLCGFGAVCEPSAEGPGRASCVCKKSTCPNVVAPVCGSDASTYSNECELQR
AQCSQQRRIRLLRRGPCAGMRDPCSNITCSFGSTCARSSDGLTATCLCPATCLGAPESPV
CGSDGTDYPSECQLLRHACARQENVFKKFDGPCGNVTSVGTPSGRALHPEMLLRPESCPS
RQAPVCGDDGVTYDNDCVMGRTGATRGLLLQKVRSGQCLPRDQCPETCRFSAVCLSCDRV
ICDGAYRPVCAHDGHTYDNDCWRQQAECQQQRSIPAKHQGPCDQPPSPCLGVQCPFGATC
AVKNGEAECVCQQTCSGLYDPVCGSDGVXACALGQEIRVARRGPCDRCGQCRFGALCEAE
TGRCVCPSECVASAQPVCGSDGHTYASECELHVHACTHQISLHVASAGHCREWGWGCPAG
CGCLAGQCVCPRCEHPPPGPVCGSDGVTYRSACELREAACEQALDQDPGLTRPPPPAAEC
GSRCSGSGEDGECEQELCRQRGGIWDEDSEDGPCVCDFXLPGCPKEPVCGSDGVTYGTEC
ELKKARCDSRQELYVVAQGACRSPTLAPRPPAVPLHCAQAPYGCCQDNITAARGVGLAGC
PSSCQCNPHGSYSGTCDPATGQCSCRPGVGXGFWNFRGIVTDGRSGCTPCSCDPQGXTGL
CSCKPGVAGPKCGQCPDGHALGPAGCETDPSAPKTCAEMPCEFGASCVEEAGSAHCVCPT
PTCLGANATKVCGSDGVTYGNECQLRTIACRQGLDISVQSLGPCQEGIASGPRPTSASVA
ASWLDLSKALLPPASALPLAPSGSHLSQPASRPSSQPWNTASIPRTTTRPVPTLPPTPPP
AAASLAMSAFGESGSADGSSDEELSGDLEASGAGSGGLLPPEGDGAGTPGPPAERASCYN
SPVGCCSDGRTPSLDAEGSNCPATKVFQGVLELEGVEGQELFYTPEMADPKSELFGETAR
SIESAVSPEPWAGVQPLPSHWPFSRDRPREAVGGGPCSPPPASSXSHHCGPPTSFSCSHS
GPAPLTTRQPPTTAPSRVPGRRPLPPGTQKPPSPCDSQPCLHGGTCQDQGPGGAFTCSCP
AGRGGTFCEEALPLSRPAFGGRSFLAFPTLRAFRALEPEGLLLYNGNARGKDFLPEHLLP
PSRFDTGSGPAVLTSSVPVQPGRWHRLELSRHWRRGTLSVDDETPVLGQSPSGTDGLNLD
TDLFVGGVPEDQAAVVLERTSVSVGLRGCIRLLDVNNQRLELSAWQGSATRSSRVGECGD
HPLVPSPXGSAPCQALEAGMFHCQWPPGRLTPPGTPSRLPPGPTCHVLPQGEAQCECPRG
RGGSLCQTASERDDAMQPFLADFNSFSYLELKGLHTFERAVGRGSIKGPLPDLLPPQGED
GAGXDGKGDFVSLALHNRLLEFRYDLGKGAAVIRSKEPVALGVWTRVSLERNGRKGAMRV
GDGPRVLGESPKSRKVPHTILNLKEPLYIGGAPDFSRLARAAXRRGPVQRGPLSWDGGRR
VRNPEHVVQAVDVSSFADHPCTQAAGHPCLNGASCLPRGASYECLCPGGFSGLHCEKGEC
CPHRAAAGGDLDALAFDGRTYVEYLNAVSLFPSELTNEIPAPEAPESGAPHSEKALQSNH
FELSLRTEATQGLVLWSGKATERADYIALAIVDGSGHTGLTLGGGPQGVVLWGEEQRATL
MASRHPSPRDQREGSLQVGNEAPVTGSSPLGATQXDTDGALWLGGLEKLPGGQALPKAYS
TGFVGCLRDVVVGRRPLHLLEDAVTKPELRPCPTP
Download sequence
Identical sequences ENSSSCP00000025417 ENSSSCP00000025417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]