SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025427 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025427
Domain Number 1 Region: 17-188,235-336
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.11e-96
Family Calpain large subunit, catalytic domain (domain II) 0.000000359
Further Details:      
 
Domain Number 2 Region: 341-420
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.7e-21
Family Calpain large subunit, middle domain (domain III) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025427   Gene: ENSSSCG00000027391   Transcript: ENSSSCT00000027241
Sequence length 423
Comment pep:novel scaffold:Sscrofa10.2:JH118557.1:72027:83986:1 gene:ENSSSCG00000027391 transcript:ENSSSCT00000027241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITLQRSLHNTXARKQNEELHSNPQFYSAKAKRLDLCQGLVGDCWFLAALQALTLHQDILS
RVVPLNQSFTEKYAGIFRFWFWHFGKWIPVVVDDRLPVNEAGQLVFVSSTYKNLFWGALL
EKAYAKLSGSYEDLQRGQVSEALVDFTGGVTMTINLVEAPCNLWDILTRAIYSRTLIGCQ
THAGVRMASSPGPGCGPPDSTNSQAQSPDVQTIRAQLSPWGRREKTDKSSLSLQKERVLE
NGLVDGHAYTLTGIRKVTSKHGPEYLVKLRNPWGKVEWKGDWSDSSSTWELLSPKERILL
LRKENDGEFWMTLRDFKTHFTLLVICKLSPGLLSQEVGQTWLYTMLEGRWEKGTTAGGQC
SAPDMFWKNPQFLLSVWRPQECRRLHMPCSVLVSLLQKPRHRHRNRKPYLAIGFYLFRVV
NQV
Download sequence
Identical sequences ENSSSCP00000025427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]