SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025432 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025432
Domain Number 1 Region: 365-587
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.35e-78
Family Adenain-like 0.000000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025432   Gene: ENSSSCG00000011794   Transcript: ENSSSCT00000029102
Sequence length 589
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:132968204:133008636:1 gene:ENSSSCG00000011794 transcript:ENSSSCT00000029102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKWLVRILGTIFRFCDRPVPSSRALLKRRRSNSSLFSTVDTDEVPAKRPRLDCFIHQVK
TSLYNAASLFGFPFQLTTKPMVTSACNGTRNVAPSGEFFSYLSMCEIFFSFNYKCILKIG
NKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLSSEGYNRRPGGRRHSKGHPESSLTWKP
QEQVVTEMISEEGGKGLRRPHCTVEEGVQKEEREKYRRLLERLKEGGHGNSVPPVTSTHH
GSQRSQMDTLKTKSWGEEQSHGVRTTQFVPKQYRVVETRGPLCSVRSEKRCSKGKISDTE
KTVGIRLDNESRRGHQLEPDLSEEVSARLRLGSGSNGLLRRKMSILETKEKNCSGKERDK
RTEDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYM
NLLMERNKKQGYPALYAFSTFFYPKLKSGGYQAVKRWTKGVNLFEQELILVPIHRKVHWS
LVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNIDLNLLEWTHYSLKPHEIP
QQLNGSDCGMFTCKYADYVSRDRPITFTQHQMPLFRKKMVWEILHQQLL
Download sequence
Identical sequences ENSSSCP00000025432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]