SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025452 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025452
Domain Number 1 Region: 293-480
Classification Level Classification E-value
Superfamily L domain-like 3.4e-44
Family L domain 0.000000165
Further Details:      
 
Domain Number 2 Region: 8-180
Classification Level Classification E-value
Superfamily L domain-like 1.5e-41
Family L domain 0.000000668
Further Details:      
 
Domain Number 3 Region: 467-598
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6e-24
Family Growth factor receptor domain 0.000000149
Further Details:      
 
Domain Number 4 Region: 682-785
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-17
Family Protein kinases, catalytic subunit 0.00000197
Further Details:      
 
Domain Number 5 Region: 157-301
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000249
Family Growth factor receptor domain 0.000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025452   Gene: ENSSSCG00000022126   Transcript: ENSSSCT00000023216
Sequence length 785
Comment pep:known scaffold:Sscrofa10.2:JH118990.1:88290:126181:1 gene:ENSSSCG00000022126 transcript:ENSSSCT00000023216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYMQNSYNLSFLKTIQEVAGYV
LIALNTVEKIPLENLQIIRGNVLYENTHALAVLSNYGANKTGLRELPMRNLQEILQGAVR
FSNNPALCHAESIQWRDIVNSDFLSNMSMDFQSQLGSCPKCDPGCLNGSCWGAGKENCQK
LTKVICAQQCSGRCRGRSPSXGCTGPRESDCLVCRRFRDEATCKDTCPPLMLYNPTTYQM
DVNPLGYSFGATCVKKCPRNYVVTDHGSCVRACSSDSYEVEEDGVRKCKKCDGPCGKVCN
GIGIGEFKDTLSINATNIKHFRNCTSISGDLHILPVAFRGDSFTRTPPLDPKELDILKTV
KEITGFLLIQAWPENRTGLHAFENLEIIRGRTKQHGQFSLAVVGLDIASLGLRSLKEISD
GDVIVSGNRNLCYANTISWKKLFGTASQKTKIINNRSEKECKAMGHICNPLCSSEGCWGP
EPRDCMSCRNFSRGKECVEKCNVLEGEPREFVENAECVQCHPECLPQAKNVTCMGRGPDS
CVRCAHYIDGPHCVKTCPAGIAGENSTLIWKFADANHVCHLCHPNCTYGCVGPGLEGCAV
DRPKIPSIATGIVGGLLLAVVLALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEA
PRQALLRILKGTPVPRVTVTHSGAAKPVHRGLWIPEGEKVKIPVAIKELREATSPKANKE
ILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWC
VQIAK
Download sequence
Identical sequences ENSSSCP00000025452 ENSSSCP00000025452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]