SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025461 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025461
Domain Number 1 Region: 1552-1590,1643-1961
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.43e-88
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000691
Further Details:      
 
Domain Number 2 Region: 247-580
Classification Level Classification E-value
Superfamily ARM repeat 0.000000115
Family HspBP1 domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000025461
Domain Number - Region: 883-965
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00804
Family Ubiquitin-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025461   Gene: ENSSSCG00000027046   Transcript: ENSSSCT00000029625
Sequence length 2568
Comment pep:known_by_projection chromosome:Sscrofa10.2:Y:502882:660050:-1 gene:ENSSSCG00000027046 transcript:ENSSSCT00000029625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATTRGSPVGGNDSQGQAPDGHSQPLFQNQTSSPDSSNENSPATPPDEQGQGDAPPQHE
DEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVQSEACQRFFR
DGLTISFTKILMDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNPH
CKFHIYNGTRPCESISSSAQLSEDELFARSSDPRSPKGWLVDLINKFGTLNGFQILHDRF
INGSALNVQIIAALIKPFGQCYEFLSQHTVKKYFIPIIEIIPQFLENLTDEELKKEAKNE
TKNDALSMIIKSLKNLASRIPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEINKV
ISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNKILSIVLRDSLHQPQYVEKLEKILRFVI
KEKALTLEDLDNIWAAQSGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNASK
KQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSCS
QDRDTQKIQWIDRFIEELRNNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRHD
LINQLQHNHALVTLVAENLAAYMNNMRLYARDHEGYDPQTVRLGSRYSHVQEVQERLNFL
RFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFFE
SNVLQLDPFLLTENGMKCFERFFKAVNCREGKLVAKRRTYMMDDLELIGLDYLWRVVMQS
NDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCILDGDKDSTN
CARQEAIRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSLIVRFPNHGRQVDD
LDIWSHTNDTVGSVRRCILNRIKANVAHTKIELFVGGELIDSEDDRKLIGQLNLKDKSVI
TAKLTQVSSNMPSSPDSSSDSSTGSPGNICHRYSDGPNPEVERCLPGVIMSQHPRYISFL
WQVADLGSNLNMPPLRDGARILMKLMPIDSTTVEKLRAICLDQAKLGENNLGQSIDSLFF
GPSASQVLYLTEVVYALLMPAGTPLADDSSDFQYHFLKSGGLRLVYSMLTRNNFLPNTDT
ETRRGAYLSGLKIAKLLLTAIGYGHVRAVAEACHPVVDGADPVTPINQVTHDQAVVLQNA
LQSIPNPSSECMLRNISIRLAQQISDEASRYMPDICVLRAIQKIIWASGCGALELIFSPN
EEITKIYEMSINASKGPDMEDEQVCCEALEVMTLCFALIPTALDALSKEKSWQTFVINLL
LHCPSKTVRQLAQEQFFLMCTRCCMGHRPLLFFITLLFTILGSTARERGKHSDDYFTLLR
HLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDNVKDTGETTGIEEPVLEGHLGVTKELLA
FQTPEKKCHIGCEKGANLIKELIDDFIFPASKVYLQCLRNGELPAEQAIPVCSSPATINA
GFELLVALAVGCVRNLKQIVDCLTEMYYMGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPSIRNNILAVEGTGSDIDDDMFSDEKQESESNVDPRDDVFGY
THQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAVLSQVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYIKGDLLEGANAYRCEKCDKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVPGVAKLEGDNVNPESQLLQQNEQSEIETAGS
TKYRLVGVLVHSGQASGGHYYSYIIQRNGRDGERNRWYKFDDGDVTECKMDDDEEMKNQC
FGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERLDTIDQDDEMIRYISDLTITKPHQI
MSPTIERSVRKKNVQFMHNRMQYSLEYFQFVKKLLTCNSIYLSPAPGQDHLLPEAEEITM
ISVQLAARFLFTTGFHTKKIVRGPASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRFSE
YLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSSFTSPGPSGQACDHLSLSDHLLRAVLN
LLRREVSEHGRHLQQYFNLFVMYANLGIAEKTQLLKLSVPATFMLVSLDEGPGPPIKYQY
AELGKLYSVVSQLIRCCNVSSRMQSSINGNPPLPNPFGDPNISQPIMPIQQNVADILFVR
TSYVKKIIEDCSNSEETIKLLRFCCWENPQFSSTVLSDLLWQVAYSYTYELRPYLDLLLQ
ILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCPVAY
QILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERSHS
ARMTLAKACELCPEEVKKATSGQQIEMEERKEPDDQEAAEEHESSPPEDTPLYPHSSGSH
YQQNNHVHGQPYTGPAAHHLNNHQKVGQRAQENYEGNEEVSASQMKDQ
Download sequence
Identical sequences ENSSSCP00000025461 XP_020936611.1.46622 XP_020936612.1.46622 XP_020936613.1.46622 ENSSSCP00000025461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]