SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025528 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025528
Domain Number 1 Region: 315-369
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000049
Family VPS37 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 59-126
Classification Level Classification E-value
Superfamily UBC-like 0.000000357
Family UBC-related 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025528   Gene: ENSSSCG00000010242   Transcript: ENSSSCT00000011211
Sequence length 385
Comment pep:novel chromosome:Sscrofa10.2:14:77703336:77704521:1 gene:ENSSSCG00000010242 transcript:ENSSSCT00000011211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGLFPLSKSDSSVAGLPSGLTNLQQRKQCLIESLRNSHSSIAEKDMKYRLPFTINLTINI
KILLRPWFPQEKPVISVYPPEQHHLVDKQGVYVTSPLINNFTMHSDLGKIIQSLSDELWK
NPPVLASASAAFLYLYSNPDEMPPWASQGFPFLPPYPPQEANRTISSLSVADTVSSSTMN
YTTAKPAAPLFGVLSNLPLPVPVTDASAPISQNDFDDKIPDVPDAFPELSELSGSQSTDM
NEQEEILLGQFLTLPQLKRIVTDKDDLIKSIEELARNLILEPSLEAKRQTSLGKYGFLTI
LKKKMRRHHELSCSMSALPAGLKVAAHEAEEESNNIAENFLEGKTDVDDFLSSFMEKKTI
YNCRKAKEEKLQQVIAVHSQFHPPL
Download sequence
Identical sequences ENSSSCP00000025528 ENSSSCP00000025528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]