SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025563 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025563
Domain Number 1 Region: 238-287
Classification Level Classification E-value
Superfamily TPR-like 0.00000438
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025563   Gene: ENSSSCG00000021419   Transcript: ENSSSCT00000029567
Sequence length 288
Comment pep:novel chromosome:Sscrofa10.2:5:103774482:103798846:1 gene:ENSSSCG00000021419 transcript:ENSSSCT00000029567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKPPSFSNSDNPAADSDSLLARTLTFLYLPTKNLWLLLCPDTLSFDWSMDAVPLLKTV
CDWRNLHTVAFYAGLLLLAYYGLKSPRGDRECNGKFAANGKQNANGHSCLSDAEYRNSEI
KPSFASKVENGIKNTASQRTQLPSTENIVVLSLSLLIIPFVPATNLFFYVGFVIAERVLY
IPSMGFCLLITVGARALYVKVQKRFLKSLIFYATATLIVFYGLKTAIRNGDWQNEEMLYR
SGIKVNPAKAWGNLGNVLKSQSKISEAESAYRNALYYRSNMADMLYNL
Download sequence
Identical sequences ENSSSCP00000025563 ENSSSCP00000025563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]