SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025570 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025570
Domain Number 1 Region: 13-137,211-705
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 7.95e-200
Family Aconitase iron-sulfur domain 0.000000000000338
Further Details:      
 
Domain Number 2 Region: 709-962
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 3.92e-71
Family LeuD-like 0.0000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025570   Gene: ENSSSCG00000029885   Transcript: ENSSSCT00000030494
Sequence length 964
Comment pep:known chromosome:Sscrofa10.2:7:52971450:53021857:-1 gene:ENSSSCG00000029885 transcript:ENSSSCT00000030494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPSAGYAFEYLIETLNDSSHKKFFNVPRLGGTKYDVLPYSIRVLLEAAVRNCDGFLMK
KEDVMNILDWKTKQSNVEVPFFPGRVLLQDFTGIPAMVDFAAMREAVKTLGGDPKKVHPA
CPTDLTVDHSLQIDFNKCAIQNAPNPGGGDLQKAGKLSPLRVQPKKLPCRGQTACRGSCD
SGDLGRNSGKFSSQIENTPILCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKWSSRVF
KNVAVIPPGTGMAHQVNLEYLSRVVFEEKDLLFPDSVVGTDSHITMVNGLGILGWGVGGI
ETEAVMLGLPVSLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQIGVAGKFVEFFGSG
VSQLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEYTGFNKAKLKSMETYLKAVKLFR
NDQDNSGEPEYSQVIQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQI
AAEKQNDTVSIHYEGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEAGLRVK
PYIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIVGYGCSTCVGNTAPLSEAVLNAVKQG
DLVTCGVLSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFRTEPLGTDPTGKNI
YLHDIWPSREEVHQIEEEHVVLSMFKALKEKIEMGNKRWNSLEAPDSVLFPWDLKSTYIR
CPSFFDKLTKEPVALQPIENAHVLLYLGDSVTTDHISPAGSIARSSAAAKYLTNRGLTPR
EFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGI
PLIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENA
DSLGLSGRETFSLTFPEELSPGVTLNIKTSTGKIFSVIASFENDVEIILYKHGGLLNFVA
RKFS
Download sequence
Identical sequences B3VKQ2
ENSSSCP00000025570 ENSSSCP00000025570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]