SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025647 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025647
Domain Number 1 Region: 374-722
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-87
Family YicI catalytic domain-like 0.0000583
Further Details:      
 
Domain Number 2 Region: 724-806
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.81e-21
Family Putative glucosidase YicI, domain 3 0.0077
Further Details:      
 
Domain Number 3 Region: 88-177,242-371
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.22e-16
Family YicI N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025647   Gene: ENSSSCG00000030653   Transcript: ENSSSCT00000023479
Sequence length 944
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:8446383:8464013:1 gene:ENSSSCG00000030653 transcript:ENSSSCT00000023479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAVAARRRRSWTGLVLACLGVCLGLTLAVDRSNFKTCEESSFCKRQRSIRPGQSPY
RALLDSLQLGPDTLTIHLINEVTKVLLVLELQGLQKNMTRIRIDELEPRRPRYRVPDVLV
AEPPTARLSVSGQDDNSVEVTVAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLNFEH
QRAPRVSQGSKDPAEGDGAQPEEAPGDGDKPEEIQGKAEKDEPGAWEETFKTHSDSKPYG
PTSVGLDFSLPGMEHVYGIPEHADSLRLKVTEGGDPYRLYNLDVFQYELYNPMALYGSVP
VLLAHSPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMLDYLQGSGETPQTDVRWMSESG
IIDVFLLLGPSVFDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVNQGFDDHN
LPCDFIWLDIEHADGKRYFTWDPSRFPQPRTMLEHLASKRRKLVAIVDPHIKVDSSYRVH
EELQNLGLYVKTRDGSDYEGWCWPGAASYPDFTNPKMRAWWADMFRFENYEGSSSNLYVW
NDMNEPSVFNGPEVTMLKDAQHYGGWEHRDLHNIYGFYVHMATADGLVLRSGGVERPFVL
SRAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGLVGLSFCGADVGGFFKNPEPELL
VRWYQMGAYQPFFRAHAHLDTGRREPWLLPTQYQDMIRDALGQRYSLLPFWYTLFYQAHR
EGVPVMRALWVHYPQDVTTFSIDDEFLLGDALLVHPVTDSEAHGVQVYLPGQGEVWYDVH
SYQKYHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSDCMKDDPITLFVALSPQGTA
QGELFLDDGHTFNYQTGHEFLLRRFSFSGNTLVSSSADSKGHFETPVWIERVVIIGAGKP
ATVVLQTKGSPESRLSFQHDPETSVLILRKPGVNVASDWSIHLR
Download sequence
Identical sequences I3LNH3
ENSSSCP00000025647 ENSSSCP00000025647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]