SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025750 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025750
Domain Number 1 Region: 1051-1096
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000353
Family Nuclear receptor coactivator interlocking domain 0.00052
Further Details:      
 
Domain Number 2 Region: 123-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000183
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000297
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00055
Further Details:      
 
Domain Number 4 Region: 32-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000432
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025750   Gene: ENSSSCG00000028798   Transcript: ENSSSCT00000022649
Sequence length 1428
Comment pep:novel scaffold:Sscrofa10.2:GL893191.2:18786:190635:-1 gene:ENSSSCG00000028798 transcript:ENSSSCT00000022649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI
VNGGSWSGEPPRRSSHTFNCRMLVKPLPDPEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNVCVMNPDLTGQAVGKPLNPLSSSSPAHQAMCSGNPGQDMTLS
SNINFPINGPKEQMGMPMGRFGGSGGMNHVSSMQATTPQGSNYALKMNSPSQSSPGMTPG
QPSSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYANSSLNALQAL
SEGHGVSLGSSLASPDLKTGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGQAESSGHPGE
QKEAGEPGLPPAVGSERPDGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASSLSDATKDS
VGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPXAEATGKELNQEASSTAPGSEVTIKQEP
VSPALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTEKEEMSFEPSDQP
GSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAIINDLMQLTAENSPVTPVGAQ
KTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGPFPPIRNNSPYSVIPQPGM
MGNQGMIGNQGNLGNSSTVHIKNNAARPAMPSGEWAPQTSAVRVTCAATISGVQQNNDNK
IMKELIPFISFKPLKRMSNNSLIQLYVKNTESRPSELEMNMGPQYSQQQAPPNQTAPWPE
SSLPARTENIWGQNWQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDR
ALGIPELVSQSQAVDPEQFSSQDSNMMLEQKAPVFPQQYASQAQMAPGSYAPMQDPNFHT
MGQRPSYATLRMQPTYQGIQPQTMSFQYPAGVRLGMGLGGSGNRQPLMNQISNVSNVNLT
LRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQRTLMMRGQGLNMTPSVANA
QQFPFPPNYGMSQQPDPGFTGAAAPQSPLMSPRMAHTQSPMLQQSQPNPAYQASSDMNGW
AQGSMGGNSMFSQQSPPHFGPQANTSMYNNNMNISVSMATSTGGMSNMNQMTGQISMTSV
TSVPTSGLSSMGPEQVNDPALRGGSLFPNQLPGMDMIKQEGDASRRIC
Download sequence
Identical sequences ENSSSCP00000025750 ENSSSCP00000025750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]