SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025758 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025758
Domain Number 1 Region: 316-441
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000243
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 2 Region: 443-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000274
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 482-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 292-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000042
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000025758
Domain Number - Region: 261-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0937
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025758   Gene: ENSSSCG00000027726   Transcript: ENSSSCT00000024788
Sequence length 722
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:280458:290229:1 gene:ENSSSCG00000027726 transcript:ENSSSCT00000024788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGADPAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGQYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDQCIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGANCETEVDECKASPCRNGGSCTDLENSFSCTCPPGFYG
RICELSAMACADGPCFNGGRCSDNPEGGYTCRCPGGFSGFNCEKKMDSCTSSPCSNGAQC
VDLGDAYLCRCRAGFSGRHCEDNVDDCASSPCANGGACRDGVNEYSCTCPPGYTGRNCSA
PVSRCEHSPCHNGATCHERALRYLCECARGYGGPNCQFLLPAPPPGPVVVDLTEKYVEGQ
TGPFPWVAVCAGVVLVLMLLLGCAAVVVCTRLRLQKRRPPADPCRGETETMNNLANCQRE
KDISVSVIGATQIKNTNKKVDLQAEPGSEKNGLKARDPAVGYNLLQDLKGAAATRDPHSK
PDAKCQPHGSAGEEKGTLTLRGGEAPERKRPDSVYAASKDTKYQSVYVISEEKDECVIAT
EV
Download sequence
Identical sequences A0A0B8RZL8 I3LNT3
ENSSSCP00000025758 ENSSSCP00000025758 XP_005659153.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]