SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025765 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025765
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-41
Family Protein kinases, catalytic subunit 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025765   Gene: ENSSSCG00000023515   Transcript: ENSSSCT00000028649
Sequence length 101
Comment pep:novel scaffold:Sscrofa10.2:GL893654.2:21:32731:-1 gene:ENSSSCG00000023515 transcript:ENSSSCT00000028649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILNHPNIVKLFEVIETDKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAV
QYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFALGG
Download sequence
Identical sequences ENSSSCP00000025765 ENSSSCP00000025765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]