SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025860 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025860
Domain Number 1 Region: 35-276
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.84e-64
Family Eukaryotic proteases 0.000000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025860   Gene: ENSSSCG00000029370   Transcript: ENSSSCT00000029558
Sequence length 278
Comment pep:known chromosome:Sscrofa10.2:7:80032969:80035591:-1 gene:ENSSSCG00000029370 transcript:ENSSSCT00000029558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPAPHALPFLPLPGPQRLAGGSTGSNRLGSPPGNMQPLLLLVALLLPPGARAGEIIGGQE
ARPHSRPYMAYVQIHTPVGMTICGGFLVRKDFVMTAARCFRRQTVVILGAHNIRRFERTQ
QHISVLRAPHPRFDQQKNLNDIMLLQLANRARQNRFVRPVALPRTQARLSPGAWCTVAGW
GLVSLSRRTDTLQEVQLTVQRDGECHRRFRFYNGRIEMCVGDPRERKSAFLGDSGGPLVC
GRVAQGIVSYGNRQGTPPAVFTRVSSFLPWIRRTMSRF
Download sequence
Identical sequences ENSSSCP00000025860 ENSSSCP00000025860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]