SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025878 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025878
Domain Number 1 Region: 289-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-42
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 1.68e-19
Family RING finger domain, C3HC4 0.0045
Further Details:      
 
Domain Number 3 Region: 93-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000672
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025878   Gene: ENSSSCG00000026546   Transcript: ENSSSCT00000028301
Sequence length 460
Comment pep:novel chromosome:Sscrofa10.2:8:46234403:46235785:-1 gene:ENSSSCG00000026546 transcript:ENSSSCT00000028301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAASLAQLQAETSCPICLDYLQDPVTTDCGHNFCHSCILQRWEDLQGDFPCPVCLQHC
PDRSLRRNTQLCHMVDVVKQLPNTEGEGKQQEEKPLCEKHHQVLSLFCEEDLELLCPQCQ
VSCDHQDHHLVPMEQAAACHRKRLKGSIEPLKKQLEEADMALDMQVSKSYELLWRVEHKK
RNLHRDVEHIKDFFEKEHNEIHVRLLNEESDVKDKIIGSEHQISEQESTLKSLLSEITGR
CVQPDLDLLTGIERIHSTYENLESPAGFSYELKKEIFPLPPQYFGLHKISTFQEYLTLDA
ETAHCSLIISQDGKTATFQGLEPNSVHKSKAFTSHPAVLGSEGFNAGRHFWQVEGRGLVE
WSLGVCKESFPRNVPIPPTPDNGCWRIQLRATTPGTGDSGNSCRIGVFLDYELGEVSFYD
LYKRSPLYLYSAIFTGKLMPYFSVGSSSTSLTLNLVEDEV
Download sequence
Identical sequences ENSSSCP00000025878 ENSSSCP00000025878 XP_003356978.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]