SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025991 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000025991
Domain Number - Region: 89-132
Classification Level Classification E-value
Superfamily AF0941-like 0.0235
Family AF0941-like 0.0059
Further Details:      
 
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0284
Family NlpC/P60 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025991   Gene: ENSSSCG00000026914   Transcript: ENSSSCT00000031257
Sequence length 162
Comment pep:putative chromosome:Sscrofa10.2:2:7653530:7681456:1 gene:ENSSSCG00000026914 transcript:ENSSSCT00000031257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALIPEPQLGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEIAGAGAASLMSALTDKALV
KKELLYEVAGRDRYQVNNKHDGKYSPLPPSKIVQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDAIMAAGIAGVGLAAVSFIGVMLSRNKRQKQ
Download sequence
Identical sequences M3TYH4
9823.ENSSSCP00000013883 NP_001231443.1.46622 ENSSSCP00000025991 ENSSSCP00000029415 ENSSSCP00000030506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]