SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026016 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026016
Domain Number 1 Region: 23-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000722
Family Growth factor receptor domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026016   Gene: ENSSSCG00000027830   Transcript: ENSSSCT00000029103
Sequence length 182
Comment pep:novel scaffold:Sscrofa10.2:JH118654.1:104054:109917:-1 gene:ENSSSCG00000027830 transcript:ENSSSCT00000029103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSACSLCPTNLVPAPLCPWDSKYAVDCPERCDTNECKSSLRCKRTVLDDCGCCRVCAAGL
GETCYRTVSGMDGVKCGPGLRCQFYSEEDDFGDEFGICKDCPYGTFGMECKQTCSCQSGI
CDRVTGKCLKFPFQYSVAKAANRRFVSHTEHDMASGDGNAVREELMKENAARSPGMKWLN
PR
Download sequence
Identical sequences ENSSSCP00000026016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]