SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026057 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026057
Domain Number 1 Region: 12-270
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-88
Family Eukaryotic proteases 0.000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026057   Gene: ENSSSCG00000021222   Transcript: ENSSSCT00000026740
Sequence length 274
Comment pep:known scaffold:Sscrofa10.2:GL896400.1:1359:2680:1 gene:ENSSSCG00000021222 transcript:ENSSSCT00000026740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNLLVLALPLLVSLVHTAPAPGQALERAGIVGGKEAPGHKWPWQVSLRCLDQYWKHFCG
GSLIHPQWVLTAAHCFGPEKADPLYIRVQLGEQHLYYQDRLLLVSRIIVHPNYYDEVNGA
DIALLELEDPVNLSSHVQPVTLPPASETFPKGTRCWVTGWGDVHSGWPLPPPYPLKQVRV
PIVENSECDMQYHLGLSTGDNIPIVRDDMLCAGSEGHDSCQGDSGGPLVCRVNGTWLQAG
VVSWGEGCALPNRPGIYTRVTHYLDWIHQCSPRE
Download sequence
Identical sequences ENSSSCP00000026057 ENSSSCP00000026057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]