SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026077 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026077
Domain Number 1 Region: 24-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.78e-32
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 2 Region: 200-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026077   Gene: ENSSSCG00000023332   Transcript: ENSSSCT00000025745
Sequence length 258
Comment pep:novel chromosome:Sscrofa10.2:7:107227533:107228862:1 gene:ENSSSCG00000023332 transcript:ENSSSCT00000025745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFTTHSVFFTLKVSVLLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVRLRFSMDCAETEVLSHKQVNDSSWHFLMVSRDRLR
TVLVLDGEGQSGELQPQRPYMDVVSDLFLGGVPADIRPSALTLDGVQAMPGFKGLILDLK
YGNSEPRLLGSQGVQLDAEGPCGERPCENGGICFLLDGHPTCDCSTTGYGGKLCSEDKAS
GDGPAHLLVLAQRFRMWG
Download sequence
Identical sequences ENSSSCP00000026077 ENSSSCP00000026077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]