SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026179 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026179
Domain Number 1 Region: 52-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-72
Family Calnexin/calreticulin 0.0000000359
Further Details:      
 
Domain Number 2 Region: 260-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 4.71e-58
Family P-domain of calnexin/calreticulin 0.000000283
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026179
Domain Number - Region: 401-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000237
Family Calnexin/calreticulin 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026179   Gene: ENSSSCG00000026360   Transcript: ENSSSCT00000025519
Sequence length 610
Comment pep:known chromosome:Sscrofa10.2:8:92112866:92167413:1 gene:ENSSSCG00000026360 transcript:ENSSSCT00000025519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFHGFRLCLGLLFISINAEFMDDSVEIDDFDENSEEIDGSEEELSSEIKYKTPQPLGEV
YFTETFDSGRLAGWVLSKAKKDDTDAEISIYDGRWEIEELKENRVPGDRGLVLKSRAKHH
AISAILAKPFVFADRPLIVQYEVNFQDGIDCGGAYIKLLADTDGLNLENFYDKTSYTIMF
GPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFE
VLIDQIVVNKGSLLEDVVPPINPPKEIEDPNDEKPDDWDERVKIPDLSAVKPEDWDESEP
AQIEDSSVVKPDGWLDDEPKFIPDPNAEKPSDWNEDMDGEWEAPHISNPACRVGCGEWRA
PMIDNPKYKGVWRPPMIDNPNYQGVWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTS
DIYFDNFIICSEKAVADRWAADGWGVKIMVENANEPSVFKQLMAATEARPWLWFIYLLTA
GLPIVLITSFCWPRKVKKKFKDAEFKKTDICKPQTKGALEQEVKEEKAALEKPVDLEEEK
KQSDGEVPEKEEECEPEEKSEEDIEIIEGQEEGNKSNKSGSEDEMKEADESTGSGDGPVK
SVRKRRVRKE
Download sequence
Identical sequences I3LQ01
ENSSSCP00000026179 XP_005666915.1.46622 XP_005666916.1.46622 ENSSSCP00000026179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]