SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026213 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026213
Domain Number 1 Region: 48-204
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.96e-31
Family Laminin G-like module 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026213
Domain Number - Region: 16-60
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00152
Family Laminin G-like module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026213   Gene: ENSSSCG00000024637   Transcript: ENSSSCT00000030844
Sequence length 204
Comment pep:novel chromosome:Sscrofa10.2:6:11130719:11142871:-1 gene:ENSSSCG00000024637 transcript:ENSSSCT00000030844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNISIISTPRENSVTCILIMSFGGIPAPGKSVSFPHKNFHGCLENLYYNGVDIIDLAKQQ
NPQIIIMGNVSFSCSQPQSVPVTFLSPRSYLALPGASREDEVSATFQFRTWNKAGLLLFS
ELQLVSGGLLLFLNDGKLKLNLYRPGKLPSDITAGVGLNDGQWHSVSLFAKRNYLSVTVD
GQVASAAPSMGPEHIYSGGSYYFG
Download sequence
Identical sequences ENSSSCP00000026213 ENSSSCP00000026213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]