SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026273 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026273
Domain Number 1 Region: 5-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-22
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 2 Region: 348-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000602
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 192-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000091
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 4 Region: 228-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 5 Region: 310-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000402
Family EGF-type module 0.022
Further Details:      
 
Domain Number 6 Region: 267-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000584
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026273   Gene: ENSSSCG00000010899   Transcript: ENSSSCT00000032484
Sequence length 427
Comment pep:novel chromosome:Sscrofa10.2:10:25001063:25010336:-1 gene:ENSSSCG00000010899 transcript:ENSSSCT00000032484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IANAVFTGQSSEIVFRSNGNITRDLTNITFGFRTRDANMTILQAEKEPEFLHVSIRESRL
LFQLQSGNGVHMLSLASLQPVNDGLWHHVTLSMTDPRAQASRWQMEVDHPAPLVTSAVAA
GSLDFLKDDIDIHVGGQATDNTQGLRGCLSTIDISGIHLSYFENVPGFMNKPQEEQFLKI
SKNPVVTGCLPFNACNSNPCSHGGRCEDMYRSYHCTCPGGWSGTHCELDVDECLSNPCFH
GNCSDSVAAYHCTCEPGYTGVHCEAVTDNCQNHQCANGATCISDDKGYSCHCPGNVTGTL
CRRASSPSAVCGKEKNFTCYNGGNCTESQGELQCTCRPGFTGEWCERDVDECASNPCLHG
GQCHDLPNKFQCVCDVAFAGARCELDVSGLSFYVSLLLWQNLFQLLSYLILRMNDEPVVE
WGEQDDD
Download sequence
Identical sequences ENSSSCP00000026273 ENSSSCP00000026273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]