SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026279 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026279
Domain Number 1 Region: 7-283
Classification Level Classification E-value
Superfamily ALDH-like 1.09e-91
Family ALDH-like 0.00000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026279   Gene: ENSSSCG00000028115   Transcript: ENSSSCT00000029261
Sequence length 316
Comment pep:novel chromosome:Sscrofa10.2:1:32551857:32561371:1 gene:ENSSSCG00000028115 transcript:ENSSSCT00000029261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTRAPWMLENFIDGKFLPCNSYLDSYDPSTGDVYCRVPNSGKEEIEAAVEAARAAFPG
WSSRSPQERSQVLHRLADLLEESLEELAQAESKDQGKTITLARTMDIPRSVQNFRFFASS
ILHHTSECTQMDHLGCLNYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPS
ELTSVTAWMMCKLLEKAGVPPGVVNIVFGTGPRAGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLEECVPTTVRSSFANQVCPPGWFLFSFVYLFNS
VASSSWIWHITVQNQG
Download sequence
Identical sequences ENSSSCP00000026279 ENSSSCP00000026279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]