SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026308 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026308
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily EF-hand 1.2e-37
Family Calmodulin-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026308   Gene: ENSSSCG00000026517   Transcript: ENSSSCT00000022471
Sequence length 153
Comment pep:known scaffold:Sscrofa10.2:JH118886.1:33194:43404:1 gene:ENSSSCG00000026517 transcript:ENSSSCT00000022471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLLTVMRCLGASPTPVEAQRHLQTHKIDK
NGELDFSTFLTIMHMQMKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMKLGEKLTHK
EVDDLFKEADIEPNGKVKYDEFIHKVTIPVQDY
Download sequence
Identical sequences I3LQD0
NP_001231548.1.46622 ENSSSCP00000026308 ENSSSCP00000026308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]