SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026311 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026311
Domain Number 1 Region: 275-448
Classification Level Classification E-value
Superfamily EF-hand 2.7e-45
Family Penta-EF-hand proteins 0.0000000803
Further Details:      
 
Domain Number 2 Region: 107-264
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.96e-43
Family Calpain large subunit, middle domain (domain III) 0.000000142
Further Details:      
 
Domain Number 3 Region: 2-103
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.71e-34
Family Calpain large subunit, catalytic domain (domain II) 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026311   Gene: ENSSSCG00000029411   Transcript: ENSSSCT00000022751
Sequence length 451
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL894320.1:16474:39450:1 gene:ENSSSCG00000029411 transcript:ENSSSCT00000022751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEAVTFQKLVKGHAYSVTVAEEVESRGSLQKLIRIRNPWGEVEWTGQWNDNCPNWNTVDP
EVRESLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDSYKKWKLTKMDGNWRRGS
TAISCHNLPNRLPRQVLYHLHLEDEGAEAWRGDVTCTFLVGLIQKHRRRQRKMGEDMHTI
GFGIYEVPEELTGQTNIHLSKNFFLTHRARERSDTFINLREVLNRFKLPPGEYILVPSTF
EPNKDGDFCIRVFSEKKADYQVVDDEIEADLEENDASEDDIDDGFRRLFAQLAGEDAEIS
AFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQK
IYREIDVDRSGTMNSYEMRKALEEAGFKLPCQLHQVIVARFADDQLIIDFDNFVRCLVRL
ETLFRIFKQLDSENTGTIELDLISWLCFSVL
Download sequence
Identical sequences ENSSSCP00000026311 ENSSSCP00000026311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]