SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026349 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026349
Domain Number 1 Region: 23-228
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.39e-36
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026349   Gene: ENSSSCG00000027683   Transcript: ENSSSCT00000024956
Sequence length 239
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:61921412:61935784:-1 gene:ENSSSCG00000027683 transcript:ENSSSCT00000024956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSYLTKFAFLTWVCPAIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVES
TFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKL
PPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHD
GKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA
Download sequence
Identical sequences ENSSSCP00000026349 ENSSSCP00000026349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]