SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026387 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026387
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-42
Family Galectin (animal S-lectin) 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026387   Gene: ENSSSCG00000024281   Transcript: ENSSSCT00000025965
Sequence length 138
Comment pep:known chromosome:Sscrofa10.2:6:43153598:43229948:1 gene:ENSSSCG00000024281 transcript:ENSSSCT00000025965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSMPHKTLLADGIRVGTVMRIRGVVPDQAGRFYVNLLCGEEPGSEAALHFNPRLDES
SVVFNSLEHGAWGREERGPGIPFQRGQPFDVLLITTDEGFKVVVGDLEYHHFRHRMPPTR
VRAVEVGGDLQLELVKIF
Download sequence
Identical sequences B7U2G7
NP_001136315.1.46622 XP_020948908.1.46622 XP_020948909.1.46622 ENSSSCP00000026387 ENSSSCP00000026387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]