SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026405 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026405
Domain Number 1 Region: 222-351
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-24
Family Laminin G-like module 0.0000653
Further Details:      
 
Domain Number 2 Region: 1-49
Classification Level Classification E-value
Superfamily GLA-domain 7.57e-19
Family GLA-domain 0.00066
Further Details:      
 
Domain Number 3 Region: 75-204
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000008
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026405
Domain Number - Region: 196-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000245
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026405   Gene: ENSSSCG00000025463   Transcript: ENSSSCT00000025181
Sequence length 358
Comment pep:known scaffold:Sscrofa10.2:GL894927.1:6946:32215:1 gene:ENSSSCG00000025463 transcript:ENSSSCT00000025181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEERKQGNLERECIEELCSKEEAREVFENDPETEYFYPAYLACLGSFRAGLFTAARLST
NAYPDLRSCVNAIPDQCNPLPCNEDGYLTCKDGQAMFTCICKSGWEGEKCELDINECKDP
ANINGGCSQICDNTPGSYHCSCKSGFIMLSNKKDCKDVDECSVKPSICGTAVCKNIPGDF
ECECPEGYRYNPTLKYCEDVDECSENMCAQLCVNYPGGYSCYCDGKRGFKLAQDQKSCEA
VPVCLPLNLDKNYELLYLAEQFVGVVLYLKFRLPEITRFSAEFDFRTYDSEGVILYAESS
DHSAWFLIALRDGKIEIQFKNEHTTKITTGGRVINDGLWNMVCFTEFIKNISTLMQFV
Download sequence
Identical sequences ENSSSCP00000026405 ENSSSCP00000026405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]