SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026525 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026525
Domain Number 1 Region: 277-334
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000054
Family ATI-like 0.039
Further Details:      
 
Domain Number 2 Region: 636-696
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000965
Family ATI-like 0.041
Further Details:      
 
Domain Number 3 Region: 788-837
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000973
Family Fibronectin type I module 0.036
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026525
Domain Number - Region: 326-373
Classification Level Classification E-value
Superfamily FnI-like domain 0.000167
Family Fibronectin type I module 0.059
Further Details:      
 
Domain Number - Region: 768-798
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000638
Family ATI-like 0.033
Further Details:      
 
Domain Number - Region: 1075-1147
Classification Level Classification E-value
Superfamily AbfB domain 0.0549
Family AbfB domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026525   Gene: ENSSSCG00000012835   Transcript: ENSSSCT00000025588
Sequence length 1311
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:39211:46989:1 gene:ENSSSCG00000012835 transcript:ENSSSCT00000025588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGTLGSKTLPTLPAAPDRGWCSTWGAGHFSTFDGHVYDFSGTCNYIFAATCEDASSTFSV
QLRRGPSGNISRVIVELGASVVTVQQGVISVKDEGVVSLPYTSHGLQMTPFGQSVRLVAK
RLELELVVVWGPGAYLMVLVEKKNVGRMCGLCGNFNGQRTDEFLSEDGKLLDPHKYAALQ
KLDDPNEICSYEAIPSPRGLQAGHAQTCSRLLTLVAPMCNVSKEPFLLSCQADMAACAQP
GWYNCSCATLSEYSRQCSMAGQPVRPWRGPGLCSVGECPANQVYRECGEPCVRTCSNPQP
SCSGFCTFGCFCPEGTVLDDSSKNHSCVPVPQCPCTRGGEVYAPGEATTAACQTCRCSGG
RWECVEQPCPHRCALEGGSFVTTFDARPYRFHGTCTYTLLQSPQLPDGGALLAVYDKSGY
SHSETSLAAVIYMSSQDKIVISRDEVITNNGDTKRLPYHTRNITVFRQTSTLIQMVSTFG
LELEVQLSSVFQVYVTVGPQFRGQTRGLCGTFNGDTTDDFTTSMGIAEGTASLFVDSWRA
GNCPAALERETDPCSMSHLNKVCAETHCAVLVKTGTVFEQCHATVDPKPFYKRCVYQACN
YEETFPHICAALGSYALACASRGVLLQGWRSSVDNCTISCTGNQTFSYNSQACDRTCLSL
SDRKQCHPSAVPVDGCNCPGTYLNHKAECVRKAQCPCLLDDNKFLLAGQSTAVNGVICHC
INGRLSCPARPLMLLEAQGRAGTGRGLGGKGQGQEQAGPPPGPTLLLQVPTKCEPGCACP
GLYENASGQCVPPEECPCEYGGVSYPRGAELHADCKSCVCSRGTWTCQQSTRCPSTCTLY
GEGHVVTFDGQRFVFDGSCEYILVTDGCGASDAQPTFKILTENVVCGNSGVTCSRAIKIL
SGDLSIVLADGNYTVSGEDPGVRFRVKAGSLHLELDATIGSAYNLSLIWNKHMTVFIKVA
GASQDTLCGLCGNYNGNMKDDFQTRSRYVASSELEFVNSWKESPLCGDTTFTLDPCSLNT
FRQSWAERKCSIINSQTFAACHSQVYHLPYYEACVRDTCGCDTGGDCECLCDAVAAYAKA
CVDKGVCIDWRSPDFCPIYCDFYNTHAQVGGGEYQYTQEVNCTWHYQPCLCPSWPQSLPG
TNIEGCYNCSRDEYFDPDKGTCVPCAPPPTTPQPTTGSPTTATQPASASTVGLSSPSPTA
TPEAPTPTPSLSATPTAPSSTQPGTAPTTGTGPTISTGESSATTSAVTTRATPTRTPTAT
PRSTATGPTVTRATTQPTAPPVSVATQSTARSTARTTVPVSGTATGPITSK
Download sequence
Identical sequences ENSSSCP00000013645 ENSSSCP00000026525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]