SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026588 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026588
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000142
Family MAM domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026588   Gene: ENSSSCG00000026693   Transcript: ENSSSCT00000024819
Sequence length 102
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:249859988:249863594:1 gene:ENSSSCG00000026693 transcript:ENSSSCT00000024819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRTGDHTSGFGYYLLANTKFTSQPGYIGRLYGPSLPGNLQYCLRFYYAIYGFLKMSDTL
AVYIFEENHMVQEKIWSVLESPRGVWMQAEITFKKPMSTKVQ
Download sequence
Identical sequences ENSSSCP00000026588 ENSSSCP00000026588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]