SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026597 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026597
Domain Number 1 Region: 1184-1229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000538
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 1363-1396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000384
Family EGF-type module 0.023
Further Details:      
 
Domain Number 3 Region: 1460-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000762
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026597
Domain Number - Region: 1446-1585
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000832
Family Growth factor receptor domain 0.0041
Further Details:      
 
Domain Number - Region: 1396-1427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0108
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1300-1332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0629
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 1220-1248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0656
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026597   Gene: ENSSSCG00000022543   Transcript: ENSSSCT00000022442
Sequence length 1592
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:90083319:90143924:-1 gene:ENSSSCG00000022543 transcript:ENSSSCT00000022442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPGGPFSRGIFFYFFKFILAPECSPGGYQFLQSPYRNVHFDSLHLQQSAIQDLICDNALS
PGWYRFLLFDRPAKMPTECVEMNHCGTQAPIWLSLRDSETLPPPGEIKHLTACATWQFLF
STTKDCCLFQIPVSVRNCGKFFVYLLQPTQGCMGYCAEAISDENLYPCGPDEIESGGDCF
RQLTASLPPPPPGRPEVVVEMIESRLFCRCTFDVSPTNNSVGFLITWSRLSSQEIKEELK
QETTIQAFSLLELDGINLRLGDRIFCSASIFFLEKPHVQSLAIKSQEFFAGIKLQPELST
ISEDGKEYQLRIESTVPIVCPEFSELDQECKISLKLTTVDEGKEERGLNLALSSCHVDLH
QTSPCANGTCSHAFVYYTAITDFSQDGSRVTNIVVEPIANEDFLWNNYIPDSIQIRVKDV
PTAYCYSFTDPHIITFDGRMYDNFKTGTFVLYKSMSRDFEVHVRQWDCGSLHYPVSCNCG
FVAKEEGDVVTFDMCSGQLHESQPYLFVKSQDVTSNIKISESYLGRKVTIWFSSGAFIRA
DLSEWGMSLTIRAPSLDYRNTLGLCGTFDENQENDFHDKNGIKIDQTFNNRVAFINEWRI
LPGKSMFDIMPVSLPSPRKPSFCGCSLETTSLYPSSNPLETVSQSEIVSACKDLKHIKFA
SLIQDLDVTSEYINSEALGRGINKHTSREENNLDFFPHEKTSHVNLTNLDLNLQKHPGNE
KQNALKSVDEGRHTQNQSNHSQEMRWDRQNRWKRQNFYEFLPLFAFQSLSQSDLEEFTYF
FPEDHTEDVHPEFVPTWPTPSGLTEYSTLALCQETLAKSGIGRHCLAFLGKRLDSVIDMC
VKDVLLKDDLSWAEAGVALLENECEKRILEEGKYNREEYRKSIQDILLVLKCPNLCSGHG
QCMEWGCACSPGFSSYDCSDSHDKVPEIIELENDGFCNIRKYNCMLVRVFGQGFKESPSV
KCEVTKLQYNSSKWVLGEAIYTHTVFRNSRTVDCQLPSNVQQSGAMALTGEKPIAKWQLK
VSNDGYKFSNPKIMIIYDGACQVCGLYEKDSCTIKENVCIIDGLCYTEGDKNPTSPCSIC
RPEISKFTWSFLEKNQPPVIQIPQAKLQTFWGENFVYQFMAFDPEGFDIHFTLDSGPVGA
NVSSAGLLMWKTESQTPQQFILHVNDDCNAETTVMIEVIVKSCDCLNGGSCVSDIQFPPG
SGAYLCVCLPGFQGDLCEEDVTECQLNPCGLGRCISGFQNYSCDCPPELKVETQFLNELT
THTVVLTSSDKSVTKEEDGKNADQRERHLKPTNGNTSAICRHPCGKNRECVAPNICKCKP
GYSGSNCQIAVCHPDCKNHGKCIKPNICECPPGHGGATCDEEYCRPPCQHGGTCLAGNLC
TCPYGFVGPRCETMVCNRHCENGGECLTPDVCQCKPGWYGPTCSTALCDPVCLNGGSCNK
PNTCLCPDGFFGAQCQNAVCHPPCKNGGHCIRNNVCTCPKGYTGRRCQKSICDPMCMNGG
KCVGPNLCSCPSGWIGNQCNTPVCFQKCKNGGECIAPGICHCPVTWEGARCQIPICTQKC
LYGGRCVLPNVCSCRTGYSGVKCEKKIQVFLH
Download sequence
Identical sequences ENSSSCP00000026597 ENSSSCP00000026597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]