SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026612 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000026612
Domain Number - Region: 97-124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00206
Family MAM domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026612   Gene: ENSSSCG00000020821   Transcript: ENSSSCT00000030690
Sequence length 130
Comment pep:known chromosome:Sscrofa10.2:8:124205750:124225878:-1 gene:ENSSSCG00000020821 transcript:ENSSSCT00000030690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVSSLPPPSPPTELRTPPPATTPERPTTRLTTVAPVATTSPRGFTVDNRIQTDPQKPRG
DVFIPRQPSNDLFEVFEIERGVSADDEAKDDPGVLIHSCNFDHGLCGWIWEKDSDLHWEP
VRDPAGKTIC
Download sequence
Identical sequences ENSSSCP00000026612 ENSSSCP00000026612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]