SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026630 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026630
Domain Number 1 Region: 65-113
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000942
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026630
Domain Number - Region: 38-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000157
Family Somatomedin B domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026630   Gene: ENSSSCG00000007461   Transcript: ENSSSCT00000030641
Sequence length 257
Comment pep:novel chromosome:Sscrofa10.2:17:57320300:57338520:1 gene:ENSSSCG00000007461 transcript:ENSSSCT00000030641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VATVSWARGPWGTRWLGQGCAALGRCCPGRDPTCAARGPPRCFCDQACGTVRDCCPDYAR
ACPAVSCVVAEWSGWSRCVKPCQVSYRVRQRHVLQEPRNGGAPCPPLEERAGCVEYRNHQ
GVECQQSLLPALITTGSYGKEREKQASTSPYFLSYYIWSVYCVQFRLGPIPGSCQQARAP
HAQWTRYLTRGHTVCVRCEWPAQDARSRRCYGDGGGARGHQLLLWQAAGHPRCRGTWERL
GQLRHCSCPEVHRLVFI
Download sequence
Identical sequences ENSSSCP00000026630 ENSSSCP00000026630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]