SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026635 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026635
Domain Number 1 Region: 12-200
Classification Level Classification E-value
Superfamily PUA domain-like 1.09e-16
Family LON domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026635   Gene: ENSSSCG00000023391   Transcript: ENSSSCT00000031189
Sequence length 221
Comment pep:novel chromosome:Sscrofa10.2:6:31815667:31827170:-1 gene:ENSSSCG00000023391 transcript:ENSSSCT00000031189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVNPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSPRNLQLVRSRLLKGTSLQSTILGVI
PNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVVKEKPYP
VAEVEQLDRLEEFPNTCKTREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRRLLDSLPR
EALPDILTSIIRTSNKEKLQVRCSPLECHMALSLLFFFFVF
Download sequence
Identical sequences ENSSSCP00000026635 ENSSSCP00000026635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]