SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026729 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026729
Domain Number 1 Region: 206-448
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.31e-83
Family Eukaryotic proteases 0.0000000624
Further Details:      
 
Domain Number 2 Region: 41-97
Classification Level Classification E-value
Superfamily GLA-domain 2.02e-21
Family GLA-domain 0.00025
Further Details:      
 
Domain Number 3 Region: 135-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000323
Family EGF-type module 0.00076
Further Details:      
 
Domain Number 4 Region: 97-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000056
Family EGF-type module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026729   Gene: ENSSSCG00000023693   Transcript: ENSSSCT00000026256
Sequence length 459
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:28724895:28735705:-1 gene:ENSSSCG00000023693 transcript:ENSSSCT00000026256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQLASLLLLLIIWAVSSTPVPPDSVFSSSQRAHQMLRSKRANSFLEELRPSSLERECKE
ETCDFEEAREIFQNTENTMAFWSKYHDGDQCAVSPPEHLCDSPCCGRGTCIDGLGGFRCD
CAQGWEGRFCLHEVRFSNCSTENGGCAHYCLEEEGGRRCRCAPGYRLGDDHLQCEPKVKF
PCGRLGNRMEKKRKSLKRDTDQVDKKEDQIDPRLVNGKQSPWGESPWQVILLDSKKKLAC
GAVLIHVSWVLTAAHCLDDYKKLTVRLGEYDLRRREKWEVDLDIKEFLVHPNYTRSTSDN
DIALLRLAEPATFSQTIVPICLPDSGLSERELTRVGQETVVTGWGYRSEAKTNRSFILNF
IKVPVAPHNECVQAMHNKISENMLCAGILGDSRDACEGDSGGPMVASFRGTWFLVGLVSW
GEGCGRLHNYGVYTKVSRYLDWIHGHIRMEEAFHKNQVP
Download sequence
Identical sequences I3LRJ4
ENSSSCP00000026729 ENSSSCP00000026729 XP_005671687.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]