SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026764 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026764
Domain Number 1 Region: 235-276,312-624
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.48e-91
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000216
Further Details:      
 
Domain Number 2 Region: 2-95
Classification Level Classification E-value
Superfamily RING/U-box 1.14e-27
Family Zf-UBP 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026764   Gene: ENSSSCG00000027775   Transcript: ENSSSCT00000023974
Sequence length 628
Comment pep:novel chromosome:Sscrofa10.2:7:42393942:42403726:-1 gene:ENSSSCG00000027775 transcript:ENSSSCT00000023974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRCKHVGRLRLAQDHSILNPQKWCCRECATTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQTQDLPLRRGRTLRSM
ASGEDAVPPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRREEALER
KKEAREVKRRLLEELASAPPRKSARLLLHAPRAAAPRAPAPRAPAGPRPVPRRAPAMAPG
VTGLRNLGNTCYMNSILQVLSHLRKFRECFLNLDPSKTEQLFPRAANGKAPLTGRLASSS
ANGGASLSRSLELIQNKEPSSKHISLCHELHTLFRVMWSGKWALVSPFAMLHSVWSLIPA
FRGYDQQDAQEFLCELLHKVQQELESEGTTRRILIPFSQRKLTKQVLKVVNTIFHGQLLS
QVTCISCNYKSNTIEPFWDLSLEFPERYHCIEKGFVPLNQTECLLTEMLAKFTETEALEG
RIYACDQCNSKRRKSNPKXLVLSEARKQLMIYRLPQVLRLHLKRFRWSGRNHREKIGVHV
VFDQVLTMEPYCCRDMLSSLDKETFAYDLSAVVMHHGKGFGSGHYTAYCYNTEGGFWVHC
NDSKLNVCSVEEVCKTQAYILFYTQRTV
Download sequence
Identical sequences ENSSSCP00000026764 ENSSSCP00000026764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]