SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026769 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026769
Domain Number 1 Region: 350-703
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.96e-143
Family Transferrin 0.0000000000488
Further Details:      
 
Domain Number 2 Region: 21-347
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.3e-124
Family Transferrin 0.000000000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026769   Gene: ENSSSCG00000029879   Transcript: ENSSSCT00000030564
Sequence length 704
Comment pep:known chromosome:Sscrofa10.2:13:32577739:32609442:-1 gene:ENSSSCG00000029879 transcript:ENSSSCT00000030564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFIPALLFLGTLGLCLAAPKKGVRWCVISTAEYSKCRQWQSKIRRTNPIFCIRRASPT
DCIRAIAAKRADAVTLDGGLVFEADQYKLRPVAAEIYGTEENPQTYYYAVAVVKKGFNFQ
LNQLQGRKSCHTGLGRSAGWNIPIGLLRRFLDWAGPPEPLQKAVAKFFSQSCVPCADGNA
YPNLCQLCIGKGKDKCACSSQEPYFGYSGAFNCLHKGIGDVAFVKESTVFENLPQKADRD
KYELLCPDNTRKPVEAFRECHLARVPSHAVVARSVNGKENSIWELLYQSQKKFGKSNPQE
FQLFGSPGQQKDLLFRDATIGFLKIPSKIDSKLYLGLPYLTAIQGLRETAAEVEARQAKV
VWCAVGPEELRKCRQWSSQSSQNLNCSLASTTEDCIVQVLKGEADAMSLDGGFIYTAGKC
GLVPVLAENQKSRQSSSSDCVHRPTQGYFAVAVVRKANGGITWNSVRGTKSCHTAVDRTA
GWNIPMGLLVNQTGSCKFDEFFSQSCAPGSQPGSNLCALCVGNDQGVDKCVPNSNERYYG
YTGAFRCLAENAGDVAFVKDVTVLDNTNGQNTEEWARELRSDDFELLCLDGTRKPVTEAQ
NCHLAVAPSHAVVSRKEKAAQVEQVLLTEQAQFGRYGKDCPDKFCLFRSETKNLLFNDNT
ECLAQLQGKTTYEKYLGSEYVTAIANLKQCSVSPLLEACAFMMR
Download sequence
Identical sequences Q6YT39
ENSSSCP00000026769 ENSSSCP00000026769 XP_020924222.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]