SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026824 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026824
Domain Number 1 Region: 2-382
Classification Level Classification E-value
Superfamily ALDH-like 5.37e-130
Family ALDH-like 0.0000000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026824   Gene: ENSSSCG00000023457   Transcript: ENSSSCT00000029284
Sequence length 383
Comment pep:novel scaffold:Sscrofa10.2:GL894914.1:7964:23617:1 gene:ENSSSCG00000023457 transcript:ENSSSCT00000029284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIPRSVQNFRFFASSILHHTSECTQMDHLGCLHYTVRTPVGIAGLISPWNLPLYLLTWK
IAPAIAAGNTVIAKPSELTSVTAWMMCKLLEKAGVPPGVVNIVFGTGPRAGEALVSHPEV
PLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLEECVPTTVRSSFANQG
EICLCTSRIFVQRSIYSEFLKRFVDATRMWKVGIPSDPSASMGALISKAHLEKVRSYIKK
ARLEGAQILCGEGVDKLNLPPRNQGGYFMLPTVITDIKDESCCMKEEIFGPVTCVVPFDS
EEEVIQRANSVKYGLAATVWSGNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSG
VGREGAKDSYEFFTEVKTVTVKH
Download sequence
Identical sequences ENSSSCP00000026824 ENSSSCP00000026824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]