SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026826 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026826
Domain Number 1 Region: 40-158
Classification Level Classification E-value
Superfamily FKBP-like 7.27e-39
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 2 Region: 150-267
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-38
Family FKBP immunophilin/proline isomerase 0.00041
Further Details:      
 
Domain Number 3 Region: 271-382
Classification Level Classification E-value
Superfamily FKBP-like 1.2e-36
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 4 Region: 376-461
Classification Level Classification E-value
Superfamily FKBP-like 4.32e-25
Family FKBP immunophilin/proline isomerase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026826   Gene: ENSSSCG00000021250   Transcript: ENSSSCT00000029905
Sequence length 461
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:44427774:44474940:-1 gene:ENSSSCG00000021250 transcript:ENSSSCT00000029905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRARSWRPPPPPLLLLLLWVTGQAAPVAGLGLGSDTELQIERRFVPDECPRTVHSGDF
VRYHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLIAGMDQALVGMCVNERRFVKIPPKLA
YGSEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQVHTYFKPPSCSRTIQVSDFVRYHYNGT
FLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGK
DIPGQASLVFDVALLDLHNPKDGISIENKVVPENCERRSQSGDFLRYHYNGTLLDGTFFD
SSYSRNRTFDTYIGQGYVIAGMDEGLLGVCIGEKRRIVVPPHLAYGEEGRGNIPGSAVLV
FDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTY
NIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGV
Download sequence
Identical sequences ENSSSCP00000026826 ENSSSCP00000026826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]