SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026835 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026835
Domain Number 1 Region: 91-464
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.1e-93
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000131
Further Details:      
 
Domain Number 2 Region: 4-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.41e-16
Family Ubiquitin-related 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026835   Gene: ENSSSCG00000022559   Transcript: ENSSSCT00000031626
Sequence length 477
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896447.1:66754:107624:-1 gene:ENSSSCG00000022559 transcript:ENSSSCT00000031626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGLFAVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKGMTLLM
MGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKD
ALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGE
QGQYLQQDANECWIQMMRVLQQKLEAIEDDTVKETDSSSASAVTPSKKKSLIDQFFGVEF
ETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALY
IKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPELSFRSKFKD
LEDKKVNQQPKASDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHY
VSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESE
Download sequence
Identical sequences ENSSSCP00000026835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]